UTP11 Peptide - N-terminal region

Artikelnummer: BYT-ORB2004221
Artikelname: UTP11 Peptide - N-terminal region
Artikelnummer: BYT-ORB2004221
Hersteller Artikelnummer: orb2004221
Alternativnummer: BYT-ORB2004221-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: CGI94, CGI-94, UTP11L
UTP11 Peptide - N-terminal region
NCBI: 057121
UniProt: Q9Y3A2
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: AKSRQREHRERSQPGFRKHLGLLEKKKDYKLRADDYRKKQEYLKALRKKA
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with UTP11 Rabbit Polyclonal Antibody (orb327144). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings