UTP11 Peptide - N-terminal region

Product Overview

• Article Name: UTP11 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004221
• Supplier Catalog Number: orb2004221
• Alternative Catalog Number: BYT-ORB2004221-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: CGI94, CGI-94, UTP11L

Product Description

UTP11 Peptide - N-terminal region

Product Properties

• NCBI: 057121
• UniProt: Q9Y3A2
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: AKSRQREHRERSQPGFRKHLGLLEKKKDYKLRADDYRKKQEYLKALRKKA

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with UTP11 Rabbit Polyclonal Antibody (orb327144). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings