TTC39C Peptide - middle region

Produktübersicht

• Artikelname: TTC39C Peptide - middle region
• Artikelnummer: BYT-ORB2004229
• Hersteller Artikelnummer: orb2004229
• Alternativnummer: BYT-ORB2004229-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: C18orf17, HsT2697

Produktbeschreibung

TTC39C Peptide - middle region

Produkteigenschaften

• NCBI: 694943
• UniProt: Q8N584
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: NLLKIINLLGFPGDRLQGLSSLMYASESKDMKAPLATLALLWYHTVVRPF

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with TTC39C Rabbit Polyclonal Antibody (orb327134). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings