TTC39C Peptide - middle region

Product Overview

• Article Name: TTC39C Peptide - middle region
• Biozol Catalog Number: BYT-ORB2004229
• Supplier Catalog Number: orb2004229
• Alternative Catalog Number: BYT-ORB2004229-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: C18orf17, HsT2697

Product Description

TTC39C Peptide - middle region

Product Properties

• NCBI: 694943
• UniProt: Q8N584
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: NLLKIINLLGFPGDRLQGLSSLMYASESKDMKAPLATLALLWYHTVVRPF

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with TTC39C Rabbit Polyclonal Antibody (orb327134). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings