TTC26 Peptide - N-terminal region

Produktübersicht

• Artikelname: TTC26 Peptide - N-terminal region
• Artikelnummer: BYT-ORB2004233
• Hersteller Artikelnummer: orb2004233
• Alternativnummer: BYT-ORB2004233-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: DYF13, dyf-13

Produktbeschreibung

TTC26 Peptide - N-terminal region

Produkteigenschaften

• NCBI: 079202
• UniProt: A0AVF1
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: LEFKRHVGEEEEDTNLWIGYCAFHLGDYKRALEEYENATKEENCNSEVWV

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with TTC26 Rabbit Polyclonal Antibody (orb587787). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings