TTC26 Peptide - N-terminal region

Catalog Number: BYT-ORB2004233
Article Name: TTC26 Peptide - N-terminal region
Biozol Catalog Number: BYT-ORB2004233
Supplier Catalog Number: orb2004233
Alternative Catalog Number: BYT-ORB2004233-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: DYF13, dyf-13
TTC26 Peptide - N-terminal region
NCBI: 079202
UniProt: A0AVF1
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: Synthetic peptide located within the following region: LEFKRHVGEEEEDTNLWIGYCAFHLGDYKRALEEYENATKEENCNSEVWV
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with TTC26 Rabbit Polyclonal Antibody (orb587787). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings