TRIM64 Peptide - N-terminal region

Artikelnummer: BYT-ORB2004237
Artikelname: TRIM64 Peptide - N-terminal region
Artikelnummer: BYT-ORB2004237
Hersteller Artikelnummer: orb2004237
Alternativnummer: BYT-ORB2004237-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: C11orf28, TRIM64A
TRIM64 Peptide - N-terminal region
NCBI: 001129958
UniProt: A6NGJ6
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: KPNFNTNVVLKKLSSLARQTRPQNINSSDNICVLHEETKELFCEADKRLL
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with TRIM64 Rabbit Polyclonal Antibody (orb587782). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings