TRIM64 Peptide - N-terminal region

Product Overview

• Article Name: TRIM64 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004237
• Supplier Catalog Number: orb2004237
• Alternative Catalog Number: BYT-ORB2004237-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: C11orf28, TRIM64A

Product Description

TRIM64 Peptide - N-terminal region

Product Properties

• NCBI: 001129958
• UniProt: A6NGJ6
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: KPNFNTNVVLKKLSSLARQTRPQNINSSDNICVLHEETKELFCEADKRLL

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with TRIM64 Rabbit Polyclonal Antibody (orb587782). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings