TRIM16 Peptide - middle region

Artikelnummer: BYT-ORB2004239
Artikelname: TRIM16 Peptide - middle region
Artikelnummer: BYT-ORB2004239
Hersteller Artikelnummer: orb2004239
Alternativnummer: BYT-ORB2004239-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: EBBP
TRIM16 Peptide - middle region
NCBI: 006461
UniProt: O95361
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: GAGTYVGLTCKGIDRKGEERNSCISGNNFSWSLQWNGKEFTAWYSDMETP
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with TRIM16 Rabbit Polyclonal Antibody (orb587780). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings