TRIM16 Peptide - middle region

Product Overview

• Article Name: TRIM16 Peptide - middle region
• Biozol Catalog Number: BYT-ORB2004239
• Supplier Catalog Number: orb2004239
• Alternative Catalog Number: BYT-ORB2004239-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: EBBP

Product Description

TRIM16 Peptide - middle region

Product Properties

• NCBI: 006461
• UniProt: O95361
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: GAGTYVGLTCKGIDRKGEERNSCISGNNFSWSLQWNGKEFTAWYSDMETP

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with TRIM16 Rabbit Polyclonal Antibody (orb587780). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings