TMPRSS11F Peptide - C-terminal region

Produktübersicht

• Artikelname: TMPRSS11F Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004240
• Hersteller Artikelnummer: orb2004240
• Alternativnummer: BYT-ORB2004240-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB

Produktbeschreibung

TMPRSS11F Peptide - C-terminal region

Produkteigenschaften

• NCBI: 997290
• UniProt: Q6ZWK6
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: IILHENYHRETNENDIALVQLSTGVEFSNIVQRVCLPDSSIKLPPKTSVF

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with TMPRSS11F Rabbit Polyclonal Antibody (orb331399). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings