TMPRSS11F Peptide - C-terminal region

Product Overview

• Article Name: TMPRSS11F Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004240
• Supplier Catalog Number: orb2004240
• Alternative Catalog Number: BYT-ORB2004240-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB

Product Description

TMPRSS11F Peptide - C-terminal region

Product Properties

• NCBI: 997290
• UniProt: Q6ZWK6
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: IILHENYHRETNENDIALVQLSTGVEFSNIVQRVCLPDSSIKLPPKTSVF

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with TMPRSS11F Rabbit Polyclonal Antibody (orb331399). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings