TMPRSS11E Peptide - N-terminal region

Produktübersicht

• Artikelname: TMPRSS11E Peptide - N-terminal region
• Artikelnummer: BYT-ORB2004241
• Hersteller Artikelnummer: orb2004241
• Alternativnummer: BYT-ORB2004241-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: DESC1, TMPRSS11E2

Produktbeschreibung

TMPRSS11E Peptide - N-terminal region

Produkteigenschaften

• NCBI: 054777
• UniProt: Q9UL52
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: CIGLTVHYVRYNQKKTYNYYSTLSFTTDKLYAEFGREASNNFTEMSQRLE

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with TMPRSS11E Rabbit Polyclonal Antibody (orb331398). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings