TMPRSS11E Peptide - N-terminal region

Product Overview

• Article Name: TMPRSS11E Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004241
• Supplier Catalog Number: orb2004241
• Alternative Catalog Number: BYT-ORB2004241-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: DESC1, TMPRSS11E2

Product Description

TMPRSS11E Peptide - N-terminal region

Product Properties

• NCBI: 054777
• UniProt: Q9UL52
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: CIGLTVHYVRYNQKKTYNYYSTLSFTTDKLYAEFGREASNNFTEMSQRLE

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with TMPRSS11E Rabbit Polyclonal Antibody (orb331398). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings