NEMP1 Peptide - N-terminal region

Produktübersicht

• Artikelname: NEMP1 Peptide - N-terminal region
• Artikelnummer: BYT-ORB2004245
• Hersteller Artikelnummer: orb2004245
• Alternativnummer: BYT-ORB2004245-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: TMEM194, TMEM194A

Produktbeschreibung

NEMP1 Peptide - N-terminal region

Produkteigenschaften

• UniProt: O14524
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: LSGCLVYGTAETDVNVVMLQESQVCEKRASQQFCYTNVLIPKWHDIWTRI

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with NEMP1 Rabbit Polyclonal Antibody (orb327128). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings