NEMP1 Peptide - N-terminal region

Product Overview

• Article Name: NEMP1 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004245
• Supplier Catalog Number: orb2004245
• Alternative Catalog Number: BYT-ORB2004245-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: TMEM194, TMEM194A

Product Description

NEMP1 Peptide - N-terminal region

Product Properties

• UniProt: O14524
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: LSGCLVYGTAETDVNVVMLQESQVCEKRASQQFCYTNVLIPKWHDIWTRI

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with NEMP1 Rabbit Polyclonal Antibody (orb327128). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings