TARM1 Peptide - C-terminal region

Produktübersicht

• Artikelname: TARM1 Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004248
• Hersteller Artikelnummer: orb2004248
• Alternativnummer: BYT-ORB2004248-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: OLT-2

Produktbeschreibung

TARM1 Peptide - C-terminal region

Produkteigenschaften

• NCBI: 001129158
• UniProt: B6A8C7
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: PGTTSSNYSLGNFVRLGLAAVIVVIMGAFLVEAWYSRNVSPGESEAFKPE

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with TARM1 Rabbit Polyclonal Antibody (orb327113). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings