TARM1 Peptide - C-terminal region

Product Overview

• Article Name: TARM1 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004248
• Supplier Catalog Number: orb2004248
• Alternative Catalog Number: BYT-ORB2004248-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: OLT-2

Product Description

TARM1 Peptide - C-terminal region

Product Properties

• NCBI: 001129158
• UniProt: B6A8C7
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: PGTTSSNYSLGNFVRLGLAAVIVVIMGAFLVEAWYSRNVSPGESEAFKPE

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with TARM1 Rabbit Polyclonal Antibody (orb327113). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings