IZUMO2 Peptide - C-terminal region

Artikelnummer: BYT-ORB2004249
Artikelname: IZUMO2 Peptide - C-terminal region
Artikelnummer: BYT-ORB2004249
Hersteller Artikelnummer: orb2004249
Alternativnummer: BYT-ORB2004249-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: C19orf41, PLAL6978, PRO21961, SCRL
IZUMO2 Peptide - C-terminal region
NCBI: 689571
UniProt: Q6UXV1
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: CIHKKYCFVDRQPRVALQYQMDSKYPRNQALLGILISVSLAVFVFVVIVV
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with IZUMO2 Rabbit Polyclonal Antibody (orb587472). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings