IZUMO2 Peptide - C-terminal region

Product Overview

• Article Name: IZUMO2 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004249
• Supplier Catalog Number: orb2004249
• Alternative Catalog Number: BYT-ORB2004249-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: C19orf41, PLAL6978, PRO21961, SCRL

Product Description

IZUMO2 Peptide - C-terminal region

Product Properties

• NCBI: 689571
• UniProt: Q6UXV1
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: CIHKKYCFVDRQPRVALQYQMDSKYPRNQALLGILISVSLAVFVFVVIVV

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with IZUMO2 Rabbit Polyclonal Antibody (orb587472). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings