ADRA1A Peptide - C-terminal region

Produktübersicht

• Artikelname: ADRA1A Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004253
• Hersteller Artikelnummer: orb2004253
• Alternativnummer: BYT-ORB2004253-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: ADRA1C, ADRA1L1, ALPHA1AAR

Produktbeschreibung

ADRA1A Peptide - C-terminal region

Produkteigenschaften

• NCBI: 150647
• UniProt: P35348
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: LKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTHFSVRLLKFSRE

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with ADRA1A Rabbit Polyclonal Antibody (orb584528). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings