ADRA1A Peptide - C-terminal region

Product Overview

• Article Name: ADRA1A Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004253
• Supplier Catalog Number: orb2004253
• Alternative Catalog Number: BYT-ORB2004253-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: ADRA1C, ADRA1L1, ALPHA1AAR

Product Description

ADRA1A Peptide - C-terminal region

Product Properties

• NCBI: 150647
• UniProt: P35348
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: LKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTHFSVRLLKFSRE

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with ADRA1A Rabbit Polyclonal Antibody (orb584528). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings