SAR1A Peptide - middle region

Artikelnummer: BYT-ORB2004255
Artikelname: SAR1A Peptide - middle region
Artikelnummer: BYT-ORB2004255
Hersteller Artikelnummer: orb2004255
Alternativnummer: BYT-ORB2004255-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: SAR1, Sara, SARA1, masra2
SAR1A Peptide - middle region
NCBI: 001136120
UniProt: Q9NR31
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: AISEERLREMFGLYGQTTGKGSVSLKELNARPLGVFMCSVLKRQGYGEGF
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with SAR1A Rabbit Polyclonal Antibody (orb583076). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings