SAR1A Peptide - middle region

Product Overview

• Article Name: SAR1A Peptide - middle region
• Biozol Catalog Number: BYT-ORB2004255
• Supplier Catalog Number: orb2004255
• Alternative Catalog Number: BYT-ORB2004255-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: SAR1, Sara, SARA1, masra2

Product Description

SAR1A Peptide - middle region

Product Properties

• NCBI: 001136120
• UniProt: Q9NR31
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: AISEERLREMFGLYGQTTGKGSVSLKELNARPLGVFMCSVLKRQGYGEGF

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with SAR1A Rabbit Polyclonal Antibody (orb583076). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings