MED19 Peptide - middle region

Produktübersicht

• Artikelname: MED19 Peptide - middle region
• Artikelnummer: BYT-ORB2004258
• Hersteller Artikelnummer: orb2004258
• Alternativnummer: BYT-ORB2004258-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: ChIP, WB
• Alternative Synonym: DT2P1G7, LCMR1

Produktbeschreibung

MED19 Peptide - middle region

Produkteigenschaften

• NCBI: 703151
• UniProt: A0JLT2
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: LPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMH

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with MED19 Rabbit Polyclonal Antibody (orb582814). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings