MED19 Peptide - middle region

Product Overview

• Article Name: MED19 Peptide - middle region
• Biozol Catalog Number: BYT-ORB2004258
• Supplier Catalog Number: orb2004258
• Alternative Catalog Number: BYT-ORB2004258-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: ChIP, WB
• Alternative Names: DT2P1G7, LCMR1

Product Description

MED19 Peptide - middle region

Product Properties

• NCBI: 703151
• UniProt: A0JLT2
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: LPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMH

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with MED19 Rabbit Polyclonal Antibody (orb582814). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings