MTBP Peptide - middle region

Produktübersicht

• Artikelname: MTBP Peptide - middle region
• Artikelnummer: BYT-ORB2004260
• Hersteller Artikelnummer: orb2004260
• Alternativnummer: BYT-ORB2004260-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB

Produktbeschreibung

MTBP Peptide - middle region

Produkteigenschaften

• UniProt: B4DUR5
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: SLADLYEEAAENLHQLSDKLPAPGRAMVDIILLLSDKDPPKLKDYLPTVG

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with MTBP Rabbit Polyclonal Antibody (orb582738). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings