MTBP Peptide - middle region

Product Overview

• Article Name: MTBP Peptide - middle region
• Biozol Catalog Number: BYT-ORB2004260
• Supplier Catalog Number: orb2004260
• Alternative Catalog Number: BYT-ORB2004260-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB

Product Description

MTBP Peptide - middle region

Product Properties

• UniProt: B4DUR5
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: SLADLYEEAAENLHQLSDKLPAPGRAMVDIILLLSDKDPPKLKDYLPTVG

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with MTBP Rabbit Polyclonal Antibody (orb582738). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings