FTSJD2 Peptide - C-terminal region

Artikelnummer: BYT-ORB2004262
Artikelname: FTSJD2 Peptide - C-terminal region
Artikelnummer: BYT-ORB2004262
Hersteller Artikelnummer: orb2004262
Alternativnummer: BYT-ORB2004262-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: KIAA0082, MTr1, hMTr1, FTSJD2
FTSJD2 Peptide - C-terminal region
NCBI: 055865
UniProt: Q8N1G2
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: YRLEEMEKIFVRLEMKIIKGSSGTPKLSYTGRDDRHFVPMGLYIVRTVNE
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with FTSJD2 Rabbit Polyclonal Antibody (orb325964). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings