FTSJD2 Peptide - C-terminal region

Product Overview

• Article Name: FTSJD2 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004262
• Supplier Catalog Number: orb2004262
• Alternative Catalog Number: BYT-ORB2004262-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: KIAA0082, MTr1, hMTr1, FTSJD2

Product Description

FTSJD2 Peptide - C-terminal region

Product Properties

• NCBI: 055865
• UniProt: Q8N1G2
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: YRLEEMEKIFVRLEMKIIKGSSGTPKLSYTGRDDRHFVPMGLYIVRTVNE

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with FTSJD2 Rabbit Polyclonal Antibody (orb325964). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings