DKK1 Peptide - C-terminal region

Produktübersicht

• Artikelname: DKK1 Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004266
• Hersteller Artikelnummer: orb2004266
• Alternativnummer: BYT-ORB2004266-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: DKK-1, SK

Produktbeschreibung

DKK1 Peptide - C-terminal region

Produkteigenschaften

• NCBI: 036374
• UniProt: O94907
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with DKK1 Rabbit Polyclonal Antibody (orb582605). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings