DKK1 Peptide - C-terminal region

Product Overview

• Article Name: DKK1 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004266
• Supplier Catalog Number: orb2004266
• Alternative Catalog Number: BYT-ORB2004266-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: DKK-1, SK

Product Description

DKK1 Peptide - C-terminal region

Product Properties

• NCBI: 036374
• UniProt: O94907
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with DKK1 Rabbit Polyclonal Antibody (orb582605). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings