APH1B Peptide - N-terminal region

Produktübersicht

• Artikelname: APH1B Peptide - N-terminal region
• Artikelnummer: BYT-ORB2004268
• Hersteller Artikelnummer: orb2004268
• Alternativnummer: BYT-ORB2004268-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: APH-1B, PRO1328, PSFL, TAAV688

Produktbeschreibung

APH1B Peptide - N-terminal region

Produkteigenschaften

• NCBI: 112591
• UniProt: Q8WW43
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: IIDNKDGPTQKYLLIFGAFVSVYIQEMFRFAYYKLLKKASEGLKSINPGE

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with APH1B Rabbit Polyclonal Antibody (orb325898). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings