APH1B Peptide - N-terminal region

Product Overview

• Article Name: APH1B Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004268
• Supplier Catalog Number: orb2004268
• Alternative Catalog Number: BYT-ORB2004268-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: APH-1B, PRO1328, PSFL, TAAV688

Product Description

APH1B Peptide - N-terminal region

Product Properties

• NCBI: 112591
• UniProt: Q8WW43
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: IIDNKDGPTQKYLLIFGAFVSVYIQEMFRFAYYKLLKKASEGLKSINPGE

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with APH1B Rabbit Polyclonal Antibody (orb325898). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings