LRRC17 Peptide - middle region

Artikelnummer: BYT-ORB2004272
Artikelname: LRRC17 Peptide - middle region
Artikelnummer: BYT-ORB2004272
Hersteller Artikelnummer: orb2004272
Alternativnummer: BYT-ORB2004272-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: P37NB
LRRC17 Peptide - middle region
NCBI: 005815
UniProt: Q8N6Y2
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: KVLTEEVFIYTPLLSYLRLYDNPWHCTCEIETLISMLQIPRNRNLGNYAK
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with LRRC17 Rabbit Polyclonal Antibody (orb581471). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings