LRRC17 Peptide - middle region

Product Overview

• Article Name: LRRC17 Peptide - middle region
• Biozol Catalog Number: BYT-ORB2004272
• Supplier Catalog Number: orb2004272
• Alternative Catalog Number: BYT-ORB2004272-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: P37NB

Product Description

LRRC17 Peptide - middle region

Product Properties

• NCBI: 005815
• UniProt: Q8N6Y2
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: KVLTEEVFIYTPLLSYLRLYDNPWHCTCEIETLISMLQIPRNRNLGNYAK

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with LRRC17 Rabbit Polyclonal Antibody (orb581471). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings