HSFY2 Peptide - middle region

Produktübersicht

• Artikelname: HSFY2 Peptide - middle region
• Artikelnummer: BYT-ORB2004273
• Hersteller Artikelnummer: orb2004273
• Alternativnummer: BYT-ORB2004273-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: HSF2L, HSFY

Produktbeschreibung

HSFY2 Peptide - middle region

Produkteigenschaften

• NCBI: 714927
• UniProt: Q96LI6
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: LSQGSLLESPSYTVCVSEPDKDDDFLSLNFPRKLWKIVESDQFKSISWDE

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with HSFY2 Rabbit Polyclonal Antibody (orb325681). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings