HSFY2 Peptide - middle region

Product Overview

• Article Name: HSFY2 Peptide - middle region
• Biozol Catalog Number: BYT-ORB2004273
• Supplier Catalog Number: orb2004273
• Alternative Catalog Number: BYT-ORB2004273-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: HSF2L, HSFY

Product Description

HSFY2 Peptide - middle region

Product Properties

• NCBI: 714927
• UniProt: Q96LI6
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: LSQGSLLESPSYTVCVSEPDKDDDFLSLNFPRKLWKIVESDQFKSISWDE

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with HSFY2 Rabbit Polyclonal Antibody (orb325681). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings