DUX4 Peptide - middle region

Artikelnummer: BYT-ORB2004275
Artikelname: DUX4 Peptide - middle region
Artikelnummer: BYT-ORB2004275
Hersteller Artikelnummer: orb2004275
Alternativnummer: BYT-ORB2004275-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
DUX4 Peptide - middle region
NCBI: 001264985
UniProt: Q9UBX2
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: ESRPWPGRRGPPEGRRKRTAVTGSQTALLLRAFEKDRFPGIAAREELARE
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with DUX4 Rabbit Polyclonal Antibody (orb581276). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings