DUX4 Peptide - middle region

Product Overview

• Article Name: DUX4 Peptide - middle region
• Biozol Catalog Number: BYT-ORB2004275
• Supplier Catalog Number: orb2004275
• Alternative Catalog Number: BYT-ORB2004275-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB

Product Description

DUX4 Peptide - middle region

Product Properties

• NCBI: 001264985
• UniProt: Q9UBX2
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: ESRPWPGRRGPPEGRRKRTAVTGSQTALLLRAFEKDRFPGIAAREELARE

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with DUX4 Rabbit Polyclonal Antibody (orb581276). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings