MRPL10 Peptide - N-terminal region

Produktübersicht

• Artikelname: MRPL10 Peptide - N-terminal region
• Artikelnummer: BYT-ORB2004289
• Hersteller Artikelnummer: orb2004289
• Alternativnummer: BYT-ORB2004289-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: L10MT, MRP-L10, MRP-L8, MRPL8, RPML8

Produktbeschreibung

MRPL10 Peptide - N-terminal region

Produkteigenschaften

• NCBI: 683685
• UniProt: Q7Z7H8
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: HLPGSSDSPASASQVAGITGRLPTLQTVRYGSKAVTRHRRVMHFQRQKLM

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with MRPL10 Rabbit Polyclonal Antibody (orb579707). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings