MRPL10 Peptide - N-terminal region

Catalog Number: BYT-ORB2004289
Article Name: MRPL10 Peptide - N-terminal region
Biozol Catalog Number: BYT-ORB2004289
Supplier Catalog Number: orb2004289
Alternative Catalog Number: BYT-ORB2004289-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: L10MT, MRP-L10, MRP-L8, MRPL8, RPML8
MRPL10 Peptide - N-terminal region
NCBI: 683685
UniProt: Q7Z7H8
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: Synthetic peptide located within the following region: HLPGSSDSPASASQVAGITGRLPTLQTVRYGSKAVTRHRRVMHFQRQKLM
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with MRPL10 Rabbit Polyclonal Antibody (orb579707). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings