NR2E1 Peptide - C-terminal region

Artikelnummer: BYT-ORB2004292
Artikelname: NR2E1 Peptide - C-terminal region
Artikelnummer: BYT-ORB2004292
Hersteller Artikelnummer: orb2004292
Alternativnummer: BYT-ORB2004292-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: TLL, TLX, XTLL
NR2E1 Peptide - C-terminal region
NCBI: 003260
UniProt: Q9Y466
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: TEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTR
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with NR2E1 Rabbit Polyclonal Antibody (orb579508). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings