NR2E1 Peptide - C-terminal region

Product Overview

• Article Name: NR2E1 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004292
• Supplier Catalog Number: orb2004292
• Alternative Catalog Number: BYT-ORB2004292-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: TLL, TLX, XTLL

Product Description

NR2E1 Peptide - C-terminal region

Product Properties

• NCBI: 003260
• UniProt: Q9Y466
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: TEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTR

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with NR2E1 Rabbit Polyclonal Antibody (orb579508). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings