EMCN Peptide - N-terminal region

Produktübersicht

• Artikelname: EMCN Peptide - N-terminal region
• Artikelnummer: BYT-ORB2004293
• Hersteller Artikelnummer: orb2004293
• Alternativnummer: BYT-ORB2004293-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: EMCN2, MUC14

Produktbeschreibung

EMCN Peptide - N-terminal region

Produkteigenschaften

• NCBI: 057326
• UniProt: Q9ULC0
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: VTILFLLPSICSSNSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTP

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with EMCN Rabbit Polyclonal Antibody (orb579495). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings