EMCN Peptide - N-terminal region

Product Overview

• Article Name: EMCN Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004293
• Supplier Catalog Number: orb2004293
• Alternative Catalog Number: BYT-ORB2004293-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: EMCN2, MUC14

Product Description

EMCN Peptide - N-terminal region

Product Properties

• NCBI: 057326
• UniProt: Q9ULC0
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: VTILFLLPSICSSNSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTP

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with EMCN Rabbit Polyclonal Antibody (orb579495). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings