UNC5C Peptide - C-terminal region

Produktübersicht

• Artikelname: UNC5C Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004294
• Hersteller Artikelnummer: orb2004294
• Alternativnummer: BYT-ORB2004294-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB

Produktbeschreibung

UNC5C Peptide - C-terminal region

Produkteigenschaften

• UniProt: O95185
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: GPVYALHDVSDKIPMTNSPILDPLPNLKIKVYNTSGAVTPQDDLSEFTSK

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with UNC5C Rabbit Polyclonal Antibody (orb330417). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings