UNC5C Peptide - C-terminal region

Product Overview

• Article Name: UNC5C Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004294
• Supplier Catalog Number: orb2004294
• Alternative Catalog Number: BYT-ORB2004294-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB

Product Description

UNC5C Peptide - C-terminal region

Product Properties

• UniProt: O95185
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: GPVYALHDVSDKIPMTNSPILDPLPNLKIKVYNTSGAVTPQDDLSEFTSK

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with UNC5C Rabbit Polyclonal Antibody (orb330417). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings