ST8SIA1 Peptide - N-terminal region

Produktübersicht

• Artikelname: ST8SIA1 Peptide - N-terminal region
• Artikelnummer: BYT-ORB2004295
• Hersteller Artikelnummer: orb2004295
• Alternativnummer: BYT-ORB2004295-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB

Produktbeschreibung

ST8SIA1 Peptide - N-terminal region

Produkteigenschaften

• UniProt: G3V1U7
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: GSFYTHSPLTIQLTLSSHRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQR

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with ST8SIA1 Rabbit Polyclonal Antibody (orb325215). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings