ST8SIA1 Peptide - N-terminal region

Catalog Number: BYT-ORB2004295
Article Name: ST8SIA1 Peptide - N-terminal region
Biozol Catalog Number: BYT-ORB2004295
Supplier Catalog Number: orb2004295
Alternative Catalog Number: BYT-ORB2004295-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
ST8SIA1 Peptide - N-terminal region
UniProt: G3V1U7
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: Synthetic peptide located within the following region: GSFYTHSPLTIQLTLSSHRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQR
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with ST8SIA1 Rabbit Polyclonal Antibody (orb325215). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings